Cloned (Comment) | Organism |
---|---|
isoform TTBK1 is expressed in HEK-293T cells | Mus musculus |
isoform TTBK2 kinase domain is expressed in Escherichia coli strain NEB2523 | Homo sapiens |
Crystallization (Comment) | Organism |
---|---|
isoform TTBK2 kinase domain with ADP, using 0.1 M Tris pH 8.5, 10% (v/v) glycerol and 2 M Na/K phosphate | Mus musculus |
isoform TTBK2 kinase domain with ADP, using 0.1 M Tris pH 8.5, 10% (v/v) glycerol and 2 M Na/K phosphate | Homo sapiens |
Protein Variants | Comment | Organism |
---|---|---|
K50A | kinase-dead mutant | Homo sapiens |
K63A | kinase-dead mutant | Homo sapiens |
Inhibitors | Comment | Organism | Structure |
---|---|---|---|
4-(2-amino-5,6,7,8-tetrahydropyrimido[4',5':3,4]cyclohept[1,2-b]indol-11-yl)-2-methyl-3-butyn-2-ol | - |
Homo sapiens | |
BIIB-TTBKi-284 | - |
Mus musculus |
Metals/Ions | Comment | Organism | Structure |
---|---|---|---|
Mg2+ | required | Mus musculus | |
Mg2+ | required | Homo sapiens |
Natural Substrates | Organism | Comment (Nat. Sub.) | Natural Products | Comment (Nat. Pro.) | Rev. | Reac. |
---|---|---|---|---|---|---|
ATP + tau-protein | Mus musculus | - |
ADP + O-phospho-tau-protein | - |
? | |
ATP + tau-protein | Homo sapiens | - |
ADP + O-phospho-tau-protein | - |
? | |
ATP + tau-protein | Homo sapiens | isoform TTBK1 is the isoform responsible for tau phosphorylation at epitopes enriched in tauopathies such as serine 422 | ADP + O-phospho-tau-protein | - |
? | |
ATP + tau-protein | Mus musculus | isoform TTBK1 is the isoform responsible for tau phosphorylation at epitopes enriched in tauopathies such as serine 422 | ADP + O-phospho-tau-protein | - |
? |
Organism | UniProt | Comment | Textmining |
---|---|---|---|
Homo sapiens | Q5TCY1 | - |
- |
Homo sapiens | Q6IQ55 | - |
- |
Mus musculus | Q3UVR3 | - |
- |
Mus musculus | Q6PCN3 | - |
- |
Purification (Comment) | Organism |
---|---|
nickel resin column chromatography and Superdex 75 gel filtration | Mus musculus |
nickel resin column chromatography and Superdex 75 gel filtration | Homo sapiens |
Source Tissue | Comment | Organism | Textmining |
---|---|---|---|
brain | - |
Homo sapiens | - |
cartilage | - |
Mus musculus | - |
cerebellum | - |
Mus musculus | - |
cerebellum | high expression | Mus musculus | - |
cerebral cortex | - |
Mus musculus | - |
cerebral cortex | high expression | Mus musculus | - |
cerebral cortical neuron | highest expression | Mus musculus | - |
additional information | not detected in blood, sciatic nerve, small intestine, skin, pancreas, muscle, and cartilage | Mus musculus | - |
additional information | not detected in blood, small intestine, spleen, skin, and pancreas | Mus musculus | - |
muscle | weakest expression | Mus musculus | - |
sciatic nerve | - |
Mus musculus | - |
spinal cord | high expression | Mus musculus | - |
spinal ganglion | - |
Mus musculus | - |
spleen | weakest expression | Mus musculus | - |
Substrates | Comment Substrates | Organism | Products | Comment (Products) | Rev. | Reac. |
---|---|---|---|---|---|---|
ATP + HLSNVSSTGSIDMVDSPQLATLADEVSASLAK | - |
Mus musculus | ADP + HLSNVSSTGSIDMVDpSPQLATLADEVSASLAK | - |
? | |
ATP + HLSNVSSTGSIDMVDSPQLATLADEVSASLAK | - |
Homo sapiens | ADP + HLSNVSSTGSIDMVDpSPQLATLADEVSASLAK | - |
? | |
ATP + tau-protein | - |
Mus musculus | ADP + O-phospho-tau-protein | - |
? | |
ATP + tau-protein | - |
Homo sapiens | ADP + O-phospho-tau-protein | - |
? | |
ATP + tau-protein | isoform TTBK1 is the isoform responsible for tau phosphorylation at epitopes enriched in tauopathies such as serine 422 | Homo sapiens | ADP + O-phospho-tau-protein | - |
? | |
ATP + tau-protein | isoform TTBK1 is the isoform responsible for tau phosphorylation at epitopes enriched in tauopathies such as serine 422 | Mus musculus | ADP + O-phospho-tau-protein | - |
? | |
additional information | isoform TTBK1 is autophosphorylated | Homo sapiens | ? | - |
- |
|
additional information | isoform TTBK1 is autophosphorylated | Mus musculus | ? | - |
- |
|
additional information | isoform TTBK2 is autophosphorylated | Mus musculus | ? | - |
- |
|
additional information | isoform TTBK2 is autophosphorylated | Homo sapiens | ? | - |
- |
Synonyms | Comment | Organism |
---|---|---|
tau-tubulin kinase | - |
Mus musculus |
tau-tubulin kinase | - |
Homo sapiens |
TTBK1 | isoform | Homo sapiens |
TTBK1 | isoform | Mus musculus |
TTBK2 | isoform | Mus musculus |
TTBK2 | isoform | Homo sapiens |
IC50 Value | IC50 Value Maximum | Comment | Organism | Inhibitor | Structure |
---|---|---|---|---|---|
0.0000095 | - |
isoform TTBK1, pH and temperature not specified in the publication | Mus musculus | BIIB-TTBKi-284 | |
0.000738 | - |
isoform TTBK1, pH and temperature not specified in the publication | Homo sapiens | 4-(2-amino-5,6,7,8-tetrahydropyrimido[4',5':3,4]cyclohept[1,2-b]indol-11-yl)-2-methyl-3-butyn-2-ol | |
0.000801 | - |
isoform TTBK1, pH and temperature not specified in the publication | Homo sapiens | 4-(2-amino-5,6,7,8-tetrahydropyrimido[4',5':3,4]cyclohept[1,2-b]indol-11-yl)-2-methyl-3-butyn-2-ol |